PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02197.1_g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 285aa    MW: 33172.8 Da    PI: 4.7564
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02197.1_g00006.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.27.1e-172067148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rg+WT eEd ll +++ q G g+W+++a++ g++R +k+c++rw++yl
  Rsa1.0_02197.1_g00006.1 20 RGPWTLEEDTLLTNYILQNGEGRWNLVAKCAGLKRNGKSCRLRWLNYL 67
                             89********************************************97 PP

2Myb_DNA-binding51.91.7e-1673116146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              rg+ T++E++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  Rsa1.0_02197.1_g00006.1  73 RGNLTPQEQLLILELHSKWGNR-WSKIAQYLP-GRTDNEIKNYWRT 116
                              7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.4281567IPR017930Myb domain
SuperFamilySSF466894.49E-3017114IPR009057Homeodomain-like
SMARTSM007171.3E-131969IPR001005SANT/Myb domain
PfamPF002491.1E-142067IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.8E-212174IPR009057Homeodomain-like
CDDcd001671.15E-92267No hitNo description
PROSITE profilePS5129424.45268122IPR017930Myb domain
SMARTSM007171.4E-1472120IPR001005SANT/Myb domain
PfamPF002491.4E-1573116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-2275121IPR009057Homeodomain-like
CDDcd001673.19E-1177116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009686Biological Processgibberellin biosynthetic process
GO:0009751Biological Processresponse to salicylic acid
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MENPMKTKSF EESEEVELRR GPWTLEEDTL LTNYILQNGE GRWNLVAKCA GLKRNGKSCR  60
LRWLNYLKPD TRRGNLTPQE QLLILELHSK WGNRWSKIAQ YLPGRTDNEI KNYWRTRVQK  120
QARQLNIESN SDKFFDAVRS FWAPRLIEKM EQNSSTNCCP QNNNNNNNNS LLPPQSYDSM  180
STQTYTDTSG QNPGLSNMDG SSSSSTFMPD LMTGPHFIDP NTIIDGSMCY QEGNYQELGG  240
YIPRMEEYFY MGNSDIGTEY HVAEAYEDVT QDPMWNMDNI WQFRE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-24171224108B-MYB
1gv2_A5e-24171221105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00216DAPTransfer from AT1G68320Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM9756550.0KM975655.1 Brassica napus MYB transcription factor 62.1 (MYB62.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009105051.10.0PREDICTED: transcription factor MYB21-like
TrEMBLA0A078JQT70.0A0A078JQT7_BRANA; BnaAnng32120D protein
STRINGBra004041.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26322571
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.11e-136myb domain protein 62